PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_36AF74187.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 324aa    MW: 35537.8 Da    PI: 6.42
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_36AF74187.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.4e-204794148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd llvd++ ++G g+W++ ar+ g++Rt+k+c++rw++yl
  Traes_1AS_36AF74187.2 47 RGPWTAEEDMLLVDYISKHGEGRWNSLARCAGLRRTGKSCRLRWLNYL 94
                           89********************************************97 PP

2Myb_DNA-binding53.45.8e-17100143146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_1AS_36AF74187.2 100 RGNITPEEQLLILDLHSRWGNR-WSKIAQRLP-GRTDNEVKNYWRT 143
                            7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.3924298IPR017930Myb domain
SuperFamilySSF466894.12E-3244141IPR009057Homeodomain-like
SMARTSM007174.8E-174696IPR001005SANT/Myb domain
PfamPF002491.2E-174794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2448101IPR009057Homeodomain-like
CDDcd001678.53E-144994No hitNo description
PROSITE profilePS5129418.81599149IPR017930Myb domain
SMARTSM007177.1E-1599147IPR001005SANT/Myb domain
PfamPF002492.1E-15100143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-23102148IPR009057Homeodomain-like
CDDcd001675.97E-12104143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDMDKEYYKA CMGMEALPMS PAGFSAVTTE AAMAVATASE DEGDLKRGPW TAEEDMLLVD  60
YISKHGEGRW NSLARCAGLR RTGKSCRLRW LNYLRPDVRR GNITPEEQLL ILDLHSRWGN  120
RWSKIAQRLP GRTDNEVKNY WRTRVQKHAK QLHCDVNSDR FRDVVRQVWM PRLLERIQAE  180
SSSSSAAAAA GVGVPALTRA MSSPAGASQY HCFDHASSGG PSRKVAVTMS PDTSSTLRSS  240
LSPAETSHGA HFPAWGAATA TANVDGSMMQ CAGREGGAIG GDQYVIHGDS LSGSWSELLA  300
ATDIPDFEFG NFDDNLWSLE DIYC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-264414124120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5872670.0EF587267.1 Triticum aestivum R2R3 Myb-like protein (PIMP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569075.11e-135PREDICTED: protein ODORANT1
TrEMBLW4ZVJ00.0W4ZVJ0_WHEAT; Uncharacterized protein
STRINGBRADI2G38560.11e-134(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.17e-78myb domain protein 112
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]